Recombinant Alkalitolerant Protein A (Freeze-Dried) _ 20543ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

Protein A is a cell wall component produced by several strains of Staphylococcus aureus, consisting of a polypeptide chain and containing almost no carbohydrates. This product is p roduced in Escherichia coli and functions similarly to natural protein A. It consists of five IgG binding domains E-D-A-B-C arranged in series, with strong specific affinity for the Fc fragment of IgG. Protein A, as an affinity ligand, is coupled to the matrix and can specifically bind to antibody molecules in the sample, allowing other impurities to flow through and exhibiting high selectivity. Commonly used for purification of monoclonal antibodies or polyclonal antibodies. Protein A binds to human, mouse, and rat IgG subclasses (e.g. human IgG1, IgG2, IgG4; mouse IgG2a, IgG2b, IgG3; rat IgG2c), as well as total IgG from rabbits, guinea pigs, pigs, dogs, and cats. Components Components No. Name 20543ES10 20543ES60 20543ES74 20543ES80 20543ES92 20543 Recombinant Alkalitolerant Protein A 10 mg 100 mg 400 mg 1 g 10 g Product Properties Synonyms Recombinant protein A alkali-tolerant Source E.coli Molecular Weight Approximately 26.7 kDa, a single non-glycosylated polypeptide chain containing 237amino acids Amino Acid Sequence AQGTVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKKLND AQAPKVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKKLN DAQAPKVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKKL NDAQAPKVDAKFDKEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQSANLLAEAKK LNDAQAPKC Concentration for 1 unity OD at 280 nm 4.4 mg/mL Physical Appearance > 97 % by SDS-PAGE and HPLC analyses. Purity > 97% by SDS-PAGE and HPLC analyses. Endotoxin Level Show more