HiActi™ Recombinant Mouse IL-28B Protein, His Tag _ 90294ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

The predicted molecular weight of Interleukin-28B (IL-28B) is 19.7 kDa. There are two isoforms of IL-28: IL-28A and IL-28B, which play a role in antiviral immune defense. This incl udes inducing an "antiviral state" by activating Mx proteins, 2',5'-oligoadenylate synthetase, and ISGF3G. Specifications Cat.No. 90294ES08 / 90294ES20 / 90294ES60 / 90294ES76 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 90294ES08 90294ES20 90294ES60 90294ES76 HiActi™ Recombinant Mouse IL-28B Protein ,His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms interleukin 28B, interferon lambda 3, IFNL3, IFN-lambda-3, IFN-lambda-4, IL28B Species Mouse Expression Sequence MVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV with polyhistidine tag at the C-terminus. Accession Q8IZI9 Tag C-His Expression System E.coli Molecular Weight The protein has a calculated MW of 25.57 kDa. The protein migrates as 21 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more