HiActi™ Recombinant Porcine IL-6 Protein, His Tag _ 90303ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

Interleukin-6 (IL-6) is a pleiotropic cytokine that plays a crucial role in the acute-phase response, inflammation, bone metabolism, lymphocyte differentiation, and cancer progress ion. Dysregulation of IL-6 production is also implicated in various diseases, including rheumatoid arthritis, Alzheimer's disease, autoimmune disorders, and different types of cancer. Specifications Cat.No. 90303ES08 Size 5 μg Components Name 90303ES08 HiActi™ Recombinant Porcine IL-6 Protein, His Tag 5 μg Performance parameters Synonyms interleukin 6, IL6 Species Porcine Expression Sequence MGRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM with polyhistidine tag at the C-terminus. Accession P26893 Tag C-His Expression System E.coli Molecular Weight The protein has a calculated MW of 21.9 kDa. The protein migrates as 23 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more