VEGF is a potent growth and angiogenic cytokine. It stimulates the proliferation and survival of endothelial cells and promotes angiogenesis and vascular permeability.VEGF is expressed in vascularized tissues and plays an important role in normal and pathological angiogenesis.VEGF has been implicated in tumor metastasis and in the induction of intraocular neovascularization syndromes.VEGF signals through three types of receptors; fms-like tyrosine kinase (flt-1), the KDR gene product (the murine homolog is the flk-1 gene product) and the flt4 gene product. Recombinant Human VEGF165 is a 38.2 kDa, disulfide-linked homodimeric protein consisting of two polypeptide chains of 165 amino acids. This product, Recombinant Human VEGF165, is supplied as a lyophilized powder with high activity, high purity and low endotoxin. Specification Synonyms Human Vascular Endothelial Growth Factor 165; MVCD1, VAS, vascular endothelial growth factor A, VEGF, VEGFA, VPF Source Human VEGF165 Protein is expressed from E.coli without tag. Ala27-Arg191 with an N-terminal Methionine Accession P15692 Molecular Weight Approximately 38.2 kDa. AA Sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEE SNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDS RCKARQLELNERTCRCDKPRR Endotoxin < 0.01 EU/μg by the LAL method. Purity > 96% by SDS-PAGE and HPLC. Biological Activity Fully biologically active when compared to standard. Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-8.0 ng/ml. Formulation Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. Physical Appearance White lyophilized powder Compounding Methods Centrifuge before uncapping to bring contents to the bottom. Use sterile distilled water or PBS to re-dissolve and re-formulate to a concentration of 0.1-1.0 mg/mL, which can be diluted even further according to subsequent experiments; for long-term storage, it is recommended that carrier protein (0.1% BSA) be added to the dilution buffer; dispense for a single experimental dosage, and freeze at -80°C to avoid repeated freezing and thawing. Cautions 1. Please operate with lab coats and disposable gloves,for your safety. 2. This product is for research use only.
