BMP-4 is a key member of the TGF-β superfamily and plays critical roles in embryonic development, cell differentiation, tissue homeostasis, and disease. Initially identified for its ability to induce bone and cartilage formation, BMP-4 is now known to regulate the development and function of multiple organ systems. BMP-4 signals by binding to type I and type II serine/threonine kinase receptors (BMPR-I/II) on the cell surface, activating downstream SMAD-dependent and -independent pathways. During embryogenesis, it drives the differentiation of mesoderm-derived tissues, including hematopoietic and renal lineages. BMP-4 also promotes osteogenic differentiation of mesenchymal stem cells, supports bone repair, maintains hematopoietic stem cell self-renewal, and inhibits preadipocyte differentiation. This recombinant human BMP-4 is expressed in E. coli, supplied in liquid format, and characterized by high purity, high bioactivity, and low endotoxin levels—making it ideal for research applications in stem cell biology, developmental studies, and regenerative medicine. Components Components No. Name 92070ES05 92070ES10 92070ES50 92070ES72 92070ES76 92070 Recombinant Human BMP-4 Protein, His Tag 2 μg 10 μg 50 μg 250 μg 500 μg Specifications Components No. Name 92070 Recombinant Human BMP-4 Protein, His Tag Protein Synonyms BMP2B ; BMP2B1; DVR4; MCOPS6; OFC11 ; ZYME Species Human Expression System E.coli Expression Sequence MGSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTN HAIVQTLVNSVNSSIP KACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRSSGLEHHHHHH Accession P12644 Tag C-His Endotoxin < 1.0 EU per 1 μg of the protein by the LAL method Purity > 95%, determined by SDS-PAGE Activity The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is 95 ng/mL. Storage This product should be stored at -25~-15℃ for 1 year. Avoid repeated freeze–thaw cycles. Centrifuge briefly before opening the vial. It is recommended to aliquot the reagent into single-use portions. Notes 1. This product is for research use only. 2. Please operate with lab coats and disposable gloves，for your safety. Figure 1. Purity Figure 1. Human BMP-4 on SDS-PAGE under reduced and non-reduced conditions. The purity is greater than 95%. 2. Cell Based Assay Figure 2. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is 95 ng/mL. Documents: Safety Data Sheet 92070_MSDS_HB251127_EN.PDF Manuals 92070_Manual_Ver.EN20251127.pdf
