HiActi™ Recombinant Mouse IGF-II Protein, His Tag _ 92206ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

Mouse insulin-like growth factor 2 (IGF-II) is a member of the insulin-like growth factor family with a molecular weight of 7.34 kDa, comprising 67 amino acid residues. IGF-II is p rimarily expressed in early embryonic somatic tissues, the liver, and the epithelial cells of the brain surface. It mediates embryonic development and placental growth, while also promoting tumor growth. IGF-II regulates cell proliferation, growth, migration, differentiation, and survival by binding to the IGF-I receptor. Specifications Cat.No. 92206ES08 / 92206ES20 / 92206ES60 / 92206ES76 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 92206ES08 92206ES20 92206ES60 92206ES76 HiActi™ Recombinant Mouse IGF-II Protein, His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms insulin-like growth factor-II, AL033362, Igf-2, M6pr, Mpr, Peg, Peg2 Species Mouse Expression Sequence AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus. Accession P09535 Tag N-His Expression System E.coli Molecular Weight The protein has a calculated MW of 8.20 kDa. The protein migrates about 11 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more